NOC3L Antikörper

Produktnummer ABIN632009

Produktdetails anti-NOC3L Antikörper

Target: NOC3L (Nucleolar Complex Associated 3 Homolog (NOC3L))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOC3L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: NOC3 L antibody was raised using a synthetic peptide corresponding to a region with amino acids TLKKYRKEQRKLRQAVKDAVSKKPIPLENPKEKRPGKRIEREEEEEEEAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NOC3L Blocking Peptide, catalog no. 33R-9174, is also available for use as a blocking control in assays to test for specificity of this NOC3L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NOC3L

Target: NOC3L (Nucleolar Complex Associated 3 Homolog (NOC3L))

Andere Bezeichnung: NOC3L (NOC3L Produkte)

Synonyme: AD24 antikoerper, C10orf117 antikoerper, FAD24 antikoerper, AF233884 antikoerper, Fad24 antikoerper, RGD1560656 antikoerper, NOC3 protein homolog antikoerper, c10orf117 antikoerper, cb522 antikoerper, sb:cb522 antikoerper, NOC3 like DNA replication regulator antikoerper, NOC3-like DNA replication regulator S homeolog antikoerper, NOC3-like DNA replication regulator antikoerper, nucleolar complex associated 3 homolog (S. cerevisiae) antikoerper, NOC3L antikoerper, Noc3l antikoerper, noc3l.S antikoerper, noc3l antikoerper

Hintergrund: NOC3L belongs to the CBF/MAK21 family. It may be required for adipogenesis.

Molekulargewicht: 92 kDa (MW of target protein)