N6AMT1 Antikörper
-
- Target Alle N6AMT1 Antikörper anzeigen
- N6AMT1 (N-6 Adenine-Specific DNA Methyltransferase 1 (Putative) (N6AMT1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser N6AMT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- N6 AMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL
- Top Product
- Discover our top product N6AMT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
N6AMT1 Blocking Peptide, catalog no. 33R-5659, is also available for use as a blocking control in assays to test for specificity of this N6AMT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of N0 MT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- N6AMT1 (N-6 Adenine-Specific DNA Methyltransferase 1 (Putative) (N6AMT1))
- Andere Bezeichnung
- N6AMT1 (N6AMT1 Produkte)
- Synonyme
- HEMK2 antikoerper, C21orf127 antikoerper, N6AMT1 antikoerper, MTQ2 antikoerper, N6AMT antikoerper, 5830445C04Rik antikoerper, Hemk2 antikoerper, Pred28 antikoerper, RGD1311843 antikoerper, N-6 adenine-specific DNA methyltransferase 1 (putative) antikoerper, N-6 adenine-specific DNA methyltransferase 1 antikoerper, HemK methyltransferase family member 2 antikoerper, uncharacterized LOC100283871 antikoerper, N6AMT1 antikoerper, CpipJ_CPIJ001152 antikoerper, LOC100283871 antikoerper, N6amt1 antikoerper
- Hintergrund
- The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
- Molekulargewicht
- 20 kDa (MW of target protein)
-