TPGS2 Antikörper (Middle Region)

Produktnummer ABIN631976

Produktdetails anti-TPGS2 Antikörper

Target: TPGS2 (C18orf10) (Chromosome 18 Open Reading Frame 10 (C18orf10))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TPGS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C18 ORF10 antibody was raised against the middle region of C18 rf10

Aufreinigung: Affinity purified

Immunogen: C18 ORF10 antibody was raised using the middle region of C18 rf10 corresponding to a region with amino acids SMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C18ORF10 Blocking Peptide, catalog no. 33R-8647, is also available for use as a blocking control in assays to test for specificity of this C18ORF10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TPGS2

Target: TPGS2 (C18orf10) (Chromosome 18 Open Reading Frame 10 (C18orf10))

Andere Bezeichnung: C18ORF10 (C18orf10 Produkte)

Synonyme: C18orf10 antikoerper, L17 antikoerper, PGs2 antikoerper, CZH18orf10 antikoerper, c18orf10 antikoerper, DKFZp468A177 antikoerper, 5730437P09Rik antikoerper, 5730494M16Rik antikoerper, AI666318 antikoerper, Pgs2 antikoerper, RGD1310571 antikoerper, C24H18orf10 antikoerper, zgc:91821 antikoerper, tubulin polyglutamylase complex subunit 2 antikoerper, tubulin polyglutamylase complex subunit 2 L homeolog antikoerper, TPGS2 antikoerper, tpgs2.L antikoerper, tpgs2 antikoerper, C18orf10 antikoerper, Tpgs2 antikoerper

Hintergrund: The function of C18orf10 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 33 kDa (MW of target protein)