TPGS2 Antikörper (Middle Region)
-
- Target Alle TPGS2 (C18orf10) Antikörper anzeigen
- TPGS2 (C18orf10) (Chromosome 18 Open Reading Frame 10 (C18orf10))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TPGS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C18 ORF10 antibody was raised against the middle region of C18 rf10
- Aufreinigung
- Affinity purified
- Immunogen
- C18 ORF10 antibody was raised using the middle region of C18 rf10 corresponding to a region with amino acids SMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVC
- Top Product
- Discover our top product C18orf10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C18ORF10 Blocking Peptide, catalog no. 33R-8647, is also available for use as a blocking control in assays to test for specificity of this C18ORF10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TPGS2 (C18orf10) (Chromosome 18 Open Reading Frame 10 (C18orf10))
- Andere Bezeichnung
- C18ORF10 (C18orf10 Produkte)
- Synonyme
- C18orf10 antikoerper, L17 antikoerper, PGs2 antikoerper, CZH18orf10 antikoerper, c18orf10 antikoerper, DKFZp468A177 antikoerper, 5730437P09Rik antikoerper, 5730494M16Rik antikoerper, AI666318 antikoerper, Pgs2 antikoerper, RGD1310571 antikoerper, C24H18orf10 antikoerper, zgc:91821 antikoerper, tubulin polyglutamylase complex subunit 2 antikoerper, tubulin polyglutamylase complex subunit 2 L homeolog antikoerper, TPGS2 antikoerper, tpgs2.L antikoerper, tpgs2 antikoerper, C18orf10 antikoerper, Tpgs2 antikoerper
- Hintergrund
- The function of C18orf10 has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 33 kDa (MW of target protein)
-