SLAIN1 Antikörper (Middle Region)

Produktnummer ABIN631967

Produktdetails anti-SLAIN1 Antikörper

Target: SLAIN1 (SLAIN Motif Family, Member 1 (SLAIN1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLAIN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLAIN1 antibody was raised against the middle region of SLAIN1

Aufreinigung: Affinity purified

Immunogen: SLAIN1 antibody was raised using the middle region of SLAIN1 corresponding to a region with amino acids RSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLAIN1 Blocking Peptide, catalog no. 33R-8203, is also available for use as a blocking control in assays to test for specificity of this SLAIN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLAIN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLAIN1

Target: SLAIN1 (SLAIN Motif Family, Member 1 (SLAIN1))

Andere Bezeichnung: SLAIN1 (SLAIN1 Produkte)

Synonyme: 9630044O09Rik antikoerper, AA675320 antikoerper, AW742596 antikoerper, C13orf32 antikoerper, RGD1308626 antikoerper, zgc:175146 antikoerper, SLAIN motif family member 1 antikoerper, SLAIN motif family, member 1 antikoerper, SLAIN motif family, member 1b antikoerper, SLAIN1 antikoerper, Slain1 antikoerper, slain1b antikoerper

Hintergrund: The function of SLAIN1 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 38 kDa (MW of target protein)