SLAIN1 Antikörper (Middle Region)
-
- Target Alle SLAIN1 Produkte
- SLAIN1 (SLAIN Motif Family, Member 1 (SLAIN1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLAIN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLAIN1 antibody was raised against the middle region of SLAIN1
- Aufreinigung
- Affinity purified
- Immunogen
- SLAIN1 antibody was raised using the middle region of SLAIN1 corresponding to a region with amino acids RSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPS
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLAIN1 Blocking Peptide, catalog no. 33R-8203, is also available for use as a blocking control in assays to test for specificity of this SLAIN1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLAIN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLAIN1 (SLAIN Motif Family, Member 1 (SLAIN1))
- Andere Bezeichnung
- SLAIN1 (SLAIN1 Produkte)
- Synonyme
- 9630044O09Rik antikoerper, AA675320 antikoerper, AW742596 antikoerper, C13orf32 antikoerper, RGD1308626 antikoerper, zgc:175146 antikoerper, SLAIN motif family member 1 antikoerper, SLAIN motif family, member 1 antikoerper, SLAIN motif family, member 1b antikoerper, SLAIN1 antikoerper, Slain1 antikoerper, slain1b antikoerper
- Hintergrund
- The function of SLAIN1 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 38 kDa (MW of target protein)
-