POLR1E Antikörper

Produktnummer ABIN631957

Produktdetails anti-POLR1E Antikörper

Target: POLR1E (Polymerase (RNA) I Polypeptide E, 53kDa (POLR1E))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POLR1E Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: POLR1 E antibody was raised using a synthetic peptide corresponding to a region with amino acids SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POLR1E Blocking Peptide, catalog no. 33R-8675, is also available for use as a blocking control in assays to test for specificity of this POLR1E antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POLR1E

Target: POLR1E (Polymerase (RNA) I Polypeptide E, 53kDa (POLR1E))

Andere Bezeichnung: POLR1E (POLR1E Produkte)

Synonyme: 53kDa antikoerper, AU042259 antikoerper, D030019D19Rik antikoerper, Paf53 antikoerper, Praf1 antikoerper, PAF53 antikoerper, PRAF1 antikoerper, RP11-405L18.3 antikoerper, RNA polymerase I subunit E antikoerper, polymerase (RNA) I polypeptide E antikoerper, polymerase (RNA) I polypeptide E L homeolog antikoerper, POLR1E antikoerper, polr1e antikoerper, Polr1e antikoerper, polr1e.L antikoerper

Hintergrund: POLR1E is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.POLR1E is the component of RNA polymerase I which synthesizes ribosomal RNA precursors.POLR1E appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF.

Molekulargewicht: 47 kDa (MW of target protein)