PRAMEF10 Antikörper (Middle Region)

Produktnummer ABIN631939

Produktdetails anti-PRAMEF10 Antikörper

Target: PRAMEF10 (PRAME Family Member 10 (PRAMEF10))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRAMEF10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRAMEF10 antibody was raised against the middle region of PRAMEF10

Aufreinigung: Affinity purified

Immunogen: PRAMEF10 antibody was raised using the middle region of PRAMEF10 corresponding to a region with amino acids DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRAMEF10 Blocking Peptide, catalog no. 33R-2057, is also available for use as a blocking control in assays to test for specificity of this PRAMEF10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRAMEF10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRAMEF10

Target: PRAMEF10 (PRAME Family Member 10 (PRAMEF10))

Andere Bezeichnung: PRAMEF10 (PRAMEF10 Produkte)

Synonyme: RP5-845O24.7 antikoerper, PRAME family member 10 antikoerper, PRAMEF10 antikoerper

Hintergrund: PRAMEF10 belongs to the PRAME family. It contains 3 LRR (leucine-rich) repeats. The function of the PRAMEF10 protein remains unknown.

Molekulargewicht: 55 kDa (MW of target protein)