ASPA Antikörper

Produktnummer ABIN631906

Produktdetails anti-ASPA Antikörper

Target: ASPA (Aspartoacylase (ASPA))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASPA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ASPA antibody was raised using a synthetic peptide corresponding to a region with amino acids RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASPA Blocking Peptide, catalog no. 33R-7964, is also available for use as a blocking control in assays to test for specificity of this ASPA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASPA

Target: ASPA (Aspartoacylase (ASPA))

Andere Bezeichnung: ASPA (ASPA Produkte)

Synonyme: asp antikoerper, acy2 antikoerper, ACY-2 antikoerper, ASP antikoerper, ACY2 antikoerper, Acy-2 antikoerper, Acy2 antikoerper, nur7 antikoerper, zgc:171507 antikoerper, aspartoacylase antikoerper, Aspartoacylase antikoerper, ASPA antikoerper, aspa antikoerper, Fbal_2465 antikoerper, Aspa antikoerper

Hintergrund: The specific function of SASP is not yet known.

Molekulargewicht: 36 kDa (MW of target protein)