DCAF4L1 Antikörper (Middle Region)

Produktnummer ABIN631904

Der Kaninchen Polyklonal anti-DCAF4L1 Antikörper wird verwendet zum Nachweis von DCAF4L1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für DCAF4L1 Antikörper (Middle Region) (ABIN631904)

Target: DCAF4L1 (DDB1 and CUL4 Associated Factor 4-Like 1 (DCAF4L1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DCAF4L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DCAF4L1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: WDR21 B antibody was raised against the middle region of WDR21

Aufreinigung: Affinity purified

Immunogen: WDR21 B antibody was raised using the middle region of WDR21 corresponding to a region with amino acids HEEEGIVVAVGQDCYTRIWSLHDAHLLRTIPSPYSASEDDIPSVAFASRL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR21B Blocking Peptide, (ABIN939100), is also available for use as a blocking control in assays to test for specificity of this WDR21B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DCAF4L1

Target: DCAF4L1 (DDB1 and CUL4 Associated Factor 4-Like 1 (DCAF4L1))

Andere Bezeichnung: WDR21B

Hintergrund: The specific function of WDR21B is not yet known.

Molekulargewicht: 44 kDa (MW of target protein)