DCAF4L1 Antikörper (Middle Region)
-
- Target Alle DCAF4L1 Produkte
- DCAF4L1 (DDB1 and CUL4 Associated Factor 4-Like 1 (DCAF4L1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DCAF4L1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WDR21 B antibody was raised against the middle region of WDR21
- Aufreinigung
- Affinity purified
- Immunogen
- WDR21 B antibody was raised using the middle region of WDR21 corresponding to a region with amino acids HEEEGIVVAVGQDCYTRIWSLHDAHLLRTIPSPYSASEDDIPSVAFASRL
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WDR21B Blocking Peptide, catalog no. 33R-3714, is also available for use as a blocking control in assays to test for specificity of this WDR21B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR20 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DCAF4L1 (DDB1 and CUL4 Associated Factor 4-Like 1 (DCAF4L1))
- Andere Bezeichnung
- WDR21B (DCAF4L1 Produkte)
- Synonyme
- WDR21B antikoerper, DDB1 and CUL4 associated factor 4 like 1 antikoerper, DCAF4L1 antikoerper
- Hintergrund
- The specific function of WDR21B is not yet known.
- Molekulargewicht
- 44 kDa (MW of target protein)
-