C21orf91 Antikörper (Middle Region)

Produktnummer ABIN631903

Produktdetails anti-C21orf91 Antikörper

Target: C21orf91 (Chromosome 21 Open Reading Frame 91 (C21orf91))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C21orf91 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C21 ORF91 antibody was raised against the middle region of C21 rf91

Aufreinigung: Affinity purified

Immunogen: C21 ORF91 antibody was raised using the middle region of C21 rf91 corresponding to a region with amino acids LCRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C21ORF91 Blocking Peptide, catalog no. 33R-4830, is also available for use as a blocking control in assays to test for specificity of this C21ORF91 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF91 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C21orf91

Target: C21orf91 (Chromosome 21 Open Reading Frame 91 (C21orf91))

Andere Bezeichnung: C21ORF91 (C21orf91 Produkte)

Synonyme: C21orf14 antikoerper, C21orf38 antikoerper, CSSG1 antikoerper, EURL antikoerper, YG81 antikoerper, C21orf91 antikoerper, 1700010I10Rik antikoerper, 2310009O17Rik antikoerper, E330003K22Rik antikoerper, Eurl antikoerper, eurl antikoerper, chromosome 21 open reading frame 91 antikoerper, chromosome 1 open reading frame, human C21orf91 antikoerper, chromosome 3 open reading frame, human C21orf91 antikoerper, chromosome 21 open reading frame 91 L homeolog antikoerper, DNA segment, Chr 16, ERATO Doi 472, expressed antikoerper, zgc:110006 antikoerper, C21orf91 antikoerper, C1H21ORF91 antikoerper, C3H21orf91 antikoerper, c21orf91.L antikoerper, c21orf91 antikoerper, C1H21orf91 antikoerper, D16Ertd472e antikoerper, zgc:110006 antikoerper

Hintergrund: The function of C21orf91 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 34 kDa (MW of target protein)