C10ORF96 Antikörper (Middle Region)
-
- Target Alle C10ORF96 (C10orf96) Antikörper anzeigen
- C10ORF96 (C10orf96) (Chromosome 10 Open Reading Frame 96 (C10orf96))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C10ORF96 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C10 ORF96 antibody was raised against the middle region of C10 rf96
- Aufreinigung
- Affinity purified
- Immunogen
- C10 ORF96 antibody was raised using the middle region of C10 rf96 corresponding to a region with amino acids QRKLKVFEDEENESICTTKYLEAEKIKISEKPQNDTECLRLKKELELYKE
- Top Product
- Discover our top product C10orf96 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C10ORF96 Blocking Peptide, catalog no. 33R-7713, is also available for use as a blocking control in assays to test for specificity of this C10ORF96 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF96 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C10ORF96 (C10orf96) (Chromosome 10 Open Reading Frame 96 (C10orf96))
- Andere Bezeichnung
- C10ORF96 (C10orf96 Produkte)
- Synonyme
- C9H10orf96 antikoerper, C10orf96 antikoerper, C26H10orf96 antikoerper, 1700011F14Rik antikoerper, coiled-coil domain containing 172 antikoerper, coiled-coil domain containing 172 L homeolog antikoerper, CCDC172 antikoerper, Ccdc172 antikoerper, ccdc172.L antikoerper
- Hintergrund
- The function of Chromosome 10 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 31 kDa (MW of target protein)
-