PAD4 Antikörper (Middle Region)

Produktnummer ABIN631895

Produktdetails anti-PAD4 Antikörper

Target: PAD4 (PADI4) (Peptidyl Arginine Deiminase, Type IV (PADI4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PADI4 antibody was raised against the middle region of PADI4

Aufreinigung: Affinity purified

Immunogen: PADI4 antibody was raised using the middle region of PADI4 corresponding to a region with amino acids TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PADI4 Blocking Peptide, catalog no. 33R-9085, is also available for use as a blocking control in assays to test for specificity of this PADI4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PADI4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAD4

Target: PAD4 (PADI4) (Peptidyl Arginine Deiminase, Type IV (PADI4))

Andere Bezeichnung: PADI4 (PADI4 Produkte)

Synonyme: PAD antikoerper, PAD4 antikoerper, PADI5 antikoerper, PDI4 antikoerper, PDI5 antikoerper, Pad4 antikoerper, Pdi4 antikoerper, peptidyl arginine deiminase 4 antikoerper, peptidyl arginine deiminase, type IV antikoerper, PADI4 antikoerper, Padi4 antikoerper

Hintergrund: PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.

Molekulargewicht: 74 kDa (MW of target protein)