IQCE Antikörper (Middle Region)

Produktnummer ABIN631892

Produktdetails anti-IQCE Antikörper

Target: IQCE (IQ Motif Containing E (IQCE))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IQCE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IQCE antibody was raised against the middle region of IQCE

Aufreinigung: Affinity purified

Immunogen: IQCE antibody was raised using the middle region of IQCE corresponding to a region with amino acids KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IQCE Blocking Peptide, catalog no. 33R-4484, is also available for use as a blocking control in assays to test for specificity of this IQCE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IQCE

Target: IQCE (IQ Motif Containing E (IQCE))

Andere Bezeichnung: IQCE (IQCE Produkte)

Synonyme: 1700028P05Rik antikoerper, mKIAA1023 antikoerper, RGD1311349 antikoerper, IQ motif containing E antikoerper, IQCE antikoerper, Iqce antikoerper

Hintergrund: IQCE contains 2 IQ domains. The functions of IQCE remain unknown.

Molekulargewicht: 77 kDa (MW of target protein)