MMD2 Antikörper (N-Term)
-
- Target Alle MMD2 Antikörper anzeigen
- MMD2 (Monocyte To Macrophage Differentiation-Associated 2 (MMD2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MMD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MMD2 antibody was raised against the N terminal of MMD2
- Aufreinigung
- Affinity purified
- Immunogen
- MMD2 antibody was raised using the N terminal of MMD2 corresponding to a region with amino acids FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL
- Top Product
- Discover our top product MMD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MMD2 Blocking Peptide, catalog no. 33R-2846, is also available for use as a blocking control in assays to test for specificity of this MMD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MMD2 (Monocyte To Macrophage Differentiation-Associated 2 (MMD2))
- Andere Bezeichnung
- MMD2 (MMD2 Produkte)
- Synonyme
- PAQR10 antikoerper, 4930518M15Rik antikoerper, C88001 antikoerper, mmd2 antikoerper, paqr10 antikoerper, si:dkey-21n8.8 antikoerper, monocyte to macrophage differentiation associated 2 antikoerper, monocyte to macrophage differentiation-associated 2 antikoerper, monocyte to macrophage differentiation-associated 2a antikoerper, MMD2 antikoerper, Mmd2 antikoerper, mmd2a antikoerper
- Hintergrund
- MMD2 contains 1 COMM domain. The exact function of MMD2 remains unknown.
- Molekulargewicht
- 31 kDa (MW of target protein)
-