MMD2 Antikörper (N-Term)

Produktnummer ABIN631886

Produktdetails anti-MMD2 Antikörper

Target: MMD2 (Monocyte To Macrophage Differentiation-Associated 2 (MMD2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MMD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MMD2 antibody was raised against the N terminal of MMD2

Aufreinigung: Affinity purified

Immunogen: MMD2 antibody was raised using the N terminal of MMD2 corresponding to a region with amino acids FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MMD2 Blocking Peptide, catalog no. 33R-2846, is also available for use as a blocking control in assays to test for specificity of this MMD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MMD2

Target: MMD2 (Monocyte To Macrophage Differentiation-Associated 2 (MMD2))

Andere Bezeichnung: MMD2 (MMD2 Produkte)

Synonyme: PAQR10 antikoerper, 4930518M15Rik antikoerper, C88001 antikoerper, mmd2 antikoerper, paqr10 antikoerper, si:dkey-21n8.8 antikoerper, monocyte to macrophage differentiation associated 2 antikoerper, monocyte to macrophage differentiation-associated 2 antikoerper, monocyte to macrophage differentiation-associated 2a antikoerper, MMD2 antikoerper, Mmd2 antikoerper, mmd2a antikoerper

Hintergrund: MMD2 contains 1 COMM domain. The exact function of MMD2 remains unknown.

Molekulargewicht: 31 kDa (MW of target protein)