PGLS Antikörper (Middle Region)
-
- Target Alle PGLS Antikörper anzeigen
- PGLS (6-phosphogluconolactonase (PGLS))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PGLS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PGLS antibody was raised against the middle region of PGLS
- Aufreinigung
- Affinity purified
- Immunogen
- PGLS antibody was raised using the middle region of PGLS corresponding to a region with amino acids AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL
- Top Product
- Discover our top product PGLS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PGLS Blocking Peptide, catalog no. 33R-1059, is also available for use as a blocking control in assays to test for specificity of this PGLS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGLS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PGLS (6-phosphogluconolactonase (PGLS))
- Andere Bezeichnung
- PGLS (PGLS Produkte)
- Synonyme
- 6PGL antikoerper, PGLS antikoerper, PSPTO1301 antikoerper, 1110030K05Rik antikoerper, AI447866 antikoerper, Plgs antikoerper, 6-phosphogluconolactonase antikoerper, PGLS antikoerper, pgl antikoerper, CND03390 antikoerper, CNE04030 antikoerper, Tb11.02.4200 antikoerper, Pgls antikoerper
- Hintergrund
- PGLS belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily. It is implicated in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.
- Molekulargewicht
- 28 kDa (MW of target protein)
-