PGLS Antikörper (Middle Region)

Produktnummer ABIN631885

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PGLS in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für PGLS Antikörper (Middle Region) (ABIN631885)

Target: PGLS (6-phosphogluconolactonase (PGLS))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PGLS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PGLS Antikörper

Bindungsspezifität: Middle Region

Spezifität: PGLS antibody was raised against the middle region of PGLS

Aufreinigung: Affinity purified

Immunogen: PGLS antibody was raised using the middle region of PGLS corresponding to a region with amino acids AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PGLS Blocking Peptide, (ABIN936445), is also available for use as a blocking control in assays to test for specificity of this PGLS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGLS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PGLS

Target: PGLS (6-phosphogluconolactonase (PGLS))

Andere Bezeichnung: PGLS

Hintergrund: PGLS belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily. It is implicated in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.

Molekulargewicht: 28 kDa (MW of target protein)