APOBEC4 Antikörper
-
- Target Alle APOBEC4 Antikörper anzeigen
- APOBEC4 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 4 (Putative) (APOBEC4))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APOBEC4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ApoBEC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VRHLNMPQMSFQETKDLGRLPTGRSVEIVEITEQFASSKEADEKKKKKGK
- Top Product
- Discover our top product APOBEC4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ApoBEC4 Blocking Peptide, catalog no. 33R-9775, is also available for use as a blocking control in assays to test for specificity of this ApoBEC4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOBEC4 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 4 (Putative) (APOBEC4))
- Andere Bezeichnung
- ApoBEC4 (APOBEC4 Produkte)
- Synonyme
- C1orf169 antikoerper, 4933431M11Rik antikoerper, apolipoprotein B mRNA editing enzyme catalytic polypeptide like 4 antikoerper, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 4 (putative) antikoerper, APOBEC4 antikoerper, Apobec4 antikoerper
- Hintergrund
- APOBEC4 is a putative C to U editing enzyme whose physiological substrate is not yet known.
- Molekulargewicht
- 41 kDa (MW of target protein)
-