CDKL2 Antikörper

Produktnummer ABIN631873

Produktdetails anti-CDKL2 Antikörper

Target: CDKL2 (Cyclin Dependent Kinase Like 2 (CDKL2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDKL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CDKL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDKL2 Blocking Peptide, catalog no. 33R-5933, is also available for use as a blocking control in assays to test for specificity of this CDKL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDKL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDKL2

Target: CDKL2 (Cyclin Dependent Kinase Like 2 (CDKL2))

Andere Bezeichnung: CDKL2 (CDKL2 Produkte)

Synonyme: KKIAMRE antikoerper, P56 antikoerper, CDKL2 antikoerper, 5330436L21Rik antikoerper, AI505225 antikoerper, Kkm antikoerper, DKFZp459L235 antikoerper, kkiamre antikoerper, cyclin dependent kinase like 2 antikoerper, cyclin-dependent kinase-like 2 (CDC2-related kinase) antikoerper, cyclin dependent kinase like 2 L homeolog antikoerper, CDKL2 antikoerper, Cdkl2 antikoerper, cdkl2.L antikoerper

Hintergrund: This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus.

Molekulargewicht: 54 kDa (MW of target protein)