TOM1L2 Antikörper

Produktnummer ABIN631872

Produktdetails anti-TOM1L2 Antikörper

Target: TOM1L2 (Target of Myb1-Like 2 (TOM1L2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TOM1L2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TOM1 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TOM1L2 Blocking Peptide, catalog no. 33R-7685, is also available for use as a blocking control in assays to test for specificity of this TOM1L2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOM0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TOM1L2

Target: TOM1L2 (Target of Myb1-Like 2 (TOM1L2))

Andere Bezeichnung: TOM1L2 (TOM1L2 Produkte)

Synonyme: 2900016I08Rik antikoerper, A730055F12Rik antikoerper, AU042072 antikoerper, Srebf1 antikoerper, target of myb1 like 2 membrane trafficking protein antikoerper, target of myb1 like 2 membrane trafficking protein L homeolog antikoerper, target of myb1-like 2 (chicken) antikoerper, TOM1L2 antikoerper, tom1l2.L antikoerper, Tom1l2 antikoerper

Hintergrund: TOM1L2 may regulate growth factor-induced mitogenic signaling.

Molekulargewicht: 55 kDa (MW of target protein)