TOM1L2 Antikörper
-
- Target Alle TOM1L2 Antikörper anzeigen
- TOM1L2 (Target of Myb1-Like 2 (TOM1L2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TOM1L2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TOM1 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSP
- Top Product
- Discover our top product TOM1L2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TOM1L2 Blocking Peptide, catalog no. 33R-7685, is also available for use as a blocking control in assays to test for specificity of this TOM1L2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOM0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TOM1L2 (Target of Myb1-Like 2 (TOM1L2))
- Andere Bezeichnung
- TOM1L2 (TOM1L2 Produkte)
- Synonyme
- 2900016I08Rik antikoerper, A730055F12Rik antikoerper, AU042072 antikoerper, Srebf1 antikoerper, target of myb1 like 2 membrane trafficking protein antikoerper, target of myb1 like 2 membrane trafficking protein L homeolog antikoerper, target of myb1-like 2 (chicken) antikoerper, TOM1L2 antikoerper, tom1l2.L antikoerper, Tom1l2 antikoerper
- Hintergrund
- TOM1L2 may regulate growth factor-induced mitogenic signaling.
- Molekulargewicht
- 55 kDa (MW of target protein)
-