ACTRT1 Antikörper (Middle Region)
-
- Target Alle ACTRT1 Antikörper anzeigen
- ACTRT1 (Actin-Related Protein T1 (ACTRT1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACTRT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACTRT1 antibody was raised against the middle region of ACTRT1
- Aufreinigung
- Affinity purified
- Immunogen
- ACTRT1 antibody was raised using the middle region of ACTRT1 corresponding to a region with amino acids DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR
- Top Product
- Discover our top product ACTRT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACTRT1 Blocking Peptide, catalog no. 33R-2190, is also available for use as a blocking control in assays to test for specificity of this ACTRT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTRT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACTRT1 (Actin-Related Protein T1 (ACTRT1))
- Andere Bezeichnung
- ACTRT1 (ACTRT1 Produkte)
- Synonyme
- 1700061J02Rik antikoerper, Arp-T1 antikoerper, AIP1 antikoerper, ARIP1 antikoerper, ARPT1 antikoerper, HSD27 antikoerper, ACTRT1 antikoerper, actin-related protein T1 antikoerper, actin related protein T1 antikoerper, Actrt1 antikoerper, ACTRT1 antikoerper, LOC539271 antikoerper, LOC100344945 antikoerper, LOC100455523 antikoerper, LOC100472383 antikoerper, LOC100154405 antikoerper
- Hintergrund
- The specific function of ACTRT1 is not yet known.
- Molekulargewicht
- 42 kDa (MW of target protein)
-