ACTRT1 Antikörper (Middle Region)

Produktnummer ABIN631862

Produktdetails anti-ACTRT1 Antikörper

Target: ACTRT1 (Actin-Related Protein T1 (ACTRT1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTRT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACTRT1 antibody was raised against the middle region of ACTRT1

Aufreinigung: Affinity purified

Immunogen: ACTRT1 antibody was raised using the middle region of ACTRT1 corresponding to a region with amino acids DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACTRT1 Blocking Peptide, catalog no. 33R-2189, is also available for use as a blocking control in assays to test for specificity of this ACTRT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTRT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACTRT1

Target: ACTRT1 (Actin-Related Protein T1 (ACTRT1))

Andere Bezeichnung: ACTRT1 (ACTRT1 Produkte)

Synonyme: 1700061J02Rik antikoerper, Arp-T1 antikoerper, AIP1 antikoerper, ARIP1 antikoerper, ARPT1 antikoerper, HSD27 antikoerper, ACTRT1 antikoerper, actin-related protein T1 antikoerper, actin related protein T1 antikoerper, Actrt1 antikoerper, ACTRT1 antikoerper, LOC539271 antikoerper, LOC100344945 antikoerper, LOC100455523 antikoerper, LOC100472383 antikoerper, LOC100154405 antikoerper

Hintergrund: The specific function of ACTRT1 is not yet known.

Molekulargewicht: 42 kDa (MW of target protein)