CYB5D1 Antikörper (Middle Region)

Produktnummer ABIN631853

Produktdetails anti-CYB5D1 Antikörper

Target: CYB5D1 (Cytochrome B5 Domain Containing 1 (CYB5D1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYB5D1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYB5 D1 antibody was raised against the middle region of CYB5 1

Aufreinigung: Affinity purified

Immunogen: CYB5 D1 antibody was raised using the middle region of CYB5 1 corresponding to a region with amino acids KYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYB5D1 Blocking Peptide, catalog no. 33R-4736, is also available for use as a blocking control in assays to test for specificity of this CYB5D1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYB0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYB5D1

Target: CYB5D1 (Cytochrome B5 Domain Containing 1 (CYB5D1))

Andere Bezeichnung: CYB5D1 (CYB5D1 Produkte)

Synonyme: RGD1559567 antikoerper, MGC146746 antikoerper, DKFZp459B103 antikoerper, Gm740 antikoerper, zgc:112008 antikoerper, cytochrome b5 domain containing 1 antikoerper, cytochrome b5 domain containing 1 L homeolog antikoerper, Cyb5d1 antikoerper, cyb5d1.L antikoerper, CYB5D1 antikoerper, cyb5d1 antikoerper

Hintergrund: The function of CYB protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 27 kDa (MW of target protein)