CPN2 Antikörper (N-Term)

Produktnummer ABIN631849

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CPN2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für CPN2 Antikörper (N-Term) (ABIN631849)

Target: CPN2 (Carboxypeptidase N Subunit 2 (CPN2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CPN2 Antikörper

Bindungsspezifität: N-Term

Spezifität: Carboxypeptidase N2 antibody was raised against the N terminal of CPN2

Aufreinigung: Affinity purified

Immunogen: Carboxypeptidase N2 antibody was raised using the N terminal of CPN2 corresponding to a region with amino acids FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carboxypeptidase N2 Blocking Peptide, (ABIN938489), is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase N2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPN2

Target: CPN2 (Carboxypeptidase N Subunit 2 (CPN2))

Andere Bezeichnung: Carboxypeptidase N2

Hintergrund: CPN2 contains 13 LRR (leucine-rich) repeats. The 83 kDa subunit binds and stabilizes the catalytic subunit at 37 degrees Celsius and keeps it in circulation. Under some circumstances it may be an allosteric modifier of the catalytic subunit.

Molekulargewicht: 60 kDa (MW of target protein)