THOC6 Antikörper
-
- Target Alle THOC6 Antikörper anzeigen
- THOC6 (THO Complex 6 Homolog (THOC6))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser THOC6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- THOC6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVR
- Top Product
- Discover our top product THOC6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
THOC6 Blocking Peptide, catalog no. 33R-1196, is also available for use as a blocking control in assays to test for specificity of this THOC6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- THOC6 (THO Complex 6 Homolog (THOC6))
- Andere Bezeichnung
- THOC6 (THOC6 Produkte)
- Synonyme
- WDR58 antikoerper, fSAP35 antikoerper, F830014G06Rik antikoerper, Wdr58 antikoerper, Pdrp antikoerper, zgc:101618 antikoerper, thoc6 antikoerper, THO complex 6 antikoerper, THO complex 6 homolog (Drosophila) antikoerper, THO complex 6 L homeolog antikoerper, THOC6 antikoerper, Thoc6 antikoerper, thoc6 antikoerper, thoc6.L antikoerper
- Hintergrund
- THOC6 belongs to the WD repeat THOC6 family.It contains 7 WD repeats. The function of the THOC6 protein remains unknown.
- Molekulargewicht
- 37 kDa (MW of target protein)
-