TBCK Antikörper (Middle Region)
-
- Target Alle TBCK Produkte
- TBCK (TBC1 Domain Containing Kinase (TBCK))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TBCK Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MGC16169 antibody was raised against the middle region of Mgc16169
- Aufreinigung
- Affinity purified
- Immunogen
- MGC16169 antibody was raised using the middle region of Mgc16169 corresponding to a region with amino acids PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA
-
anti-TBC1 Domain Containing Kinase (TBCK) (AA 601-700) antibody
TBCK Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 7A7 unconjugated
anti-TBC1 Domain Containing Kinase (TBCK) antibodyTBCK Reaktivität: Human WB, IF, ICC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-TBC1 Domain Containing Kinase (TBCK) antibodyTBCK Reaktivität: Human, Maus ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-TBC1 Domain Containing Kinase (TBCK) (AA 109-135), (N-Term) antibodyTBCK Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal RB37647 unconjugated
anti-TBC1 Domain Containing Kinase (TBCK) (AA 1-830) antibodyTBCK Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-TBC1 Domain Containing Kinase (TBCK) (AA 287-336) antibodyTBCK Reaktivität: Human, Maus, Rind (Kuh), Hund, Pferd, Schwein, Kaninchen, Ratte, Zebrafisch (Danio rerio), Huhn, Fledermaus, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MGC16169 Blocking Peptide, catalog no. 33R-7258, is also available for use as a blocking control in assays to test for specificity of this MGC16169 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC16169 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TBCK (TBC1 Domain Containing Kinase (TBCK))
- Abstract
- TBCK Produkte
- Synonyme
- Tbckl antikoerper, RGD1307816 antikoerper, tbckl antikoerper, hspc302 antikoerper, MGC82809 antikoerper, im:7138354 antikoerper, wu:fc74a10 antikoerper, zgc:158710 antikoerper, MGC122549 antikoerper, TBCKL antikoerper, 1700120J03Rik antikoerper, 9430001M19 antikoerper, A630047E20Rik antikoerper, C030007I09Rik antikoerper, TBC1 domain containing kinase antikoerper, TBC1 domain containing kinase L homeolog antikoerper, Tbck antikoerper, tbck.L antikoerper, TBCK antikoerper, tbck antikoerper
- Hintergrund
- The function of MGC16169 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 94 kDa (MW of target protein)
-
