TBCK Antikörper (Middle Region)

Produktnummer ABIN631832

Der Kaninchen Polyklonal anti-TBCK Antikörper wird verwendet zum Nachweis von TBCK in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für TBCK Antikörper (Middle Region) (ABIN631832)

Target: TBCK (TBC1 Domain Containing Kinase (TBCK))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBCK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TBCK Antikörper

Bindungsspezifität: Middle Region

Spezifität: MGC16169 antibody was raised against the middle region of Mgc16169

Aufreinigung: Affinity purified

Immunogen: MGC16169 antibody was raised using the middle region of Mgc16169 corresponding to a region with amino acids PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGC16169 Blocking Peptide, (ABIN5614743), is also available for use as a blocking control in assays to test for specificity of this MGC16169 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC16169 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBCK

Target: TBCK (TBC1 Domain Containing Kinase (TBCK))

Hintergrund: The function of MGC16169 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 94 kDa (MW of target protein)