ERCC6L Antikörper (N-Term)
-
- Target Alle ERCC6L Antikörper anzeigen
- ERCC6L (Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 6-Like (ERCC6L))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ERCC6L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ERCC6 L antibody was raised against the N terminal Of Ercc6
- Aufreinigung
- Affinity purified
- Immunogen
- ERCC6 L antibody was raised using the N terminal Of Ercc6 corresponding to a region with amino acids GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS
- Top Product
- Discover our top product ERCC6L Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ERCC6L Blocking Peptide, catalog no. 33R-3202, is also available for use as a blocking control in assays to test for specificity of this ERCC6L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERCC0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERCC6L (Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 6-Like (ERCC6L))
- Andere Bezeichnung
- ERCC6L (ERCC6L Produkte)
- Synonyme
- PICH antikoerper, RAD26L antikoerper, BC004701 antikoerper, D330021P09Rik antikoerper, RGD1565734 antikoerper, fc22h03 antikoerper, si:ch211-278b8.3 antikoerper, wu:fc22h03 antikoerper, ERCC excision repair 6 like, spindle assembly checkpoint helicase antikoerper, excision repair cross-complementing rodent repair deficiency complementation group 6 like antikoerper, DNA excision repair protein ERCC-6-like antikoerper, excision repair cross-complementation group 6-like antikoerper, ERCC6L antikoerper, Ercc6l antikoerper, LOC100373376 antikoerper, LOC100494766 antikoerper, LOC100552957 antikoerper, LOC100560751 antikoerper, LOC100563247 antikoerper, ercc6l antikoerper
- Hintergrund
- ERCC6L is a DNA helicase that acts as an essential component of the spindle assembly checkpoint.ERCC6L contributes to the mitotic checkpoint by recruiting MAD2 to kinetochores and monitoring tension on centromeric chromatin. ERCC6L acts as a tension sensor that associates with catenated DNA which is stretched under tension until it is resolved during anaphase.
- Molekulargewicht
- 141 kDa (MW of target protein)
-