KHDRBS2 Antikörper (Middle Region)

Produktnummer ABIN631800

Produktdetails anti-KHDRBS2 Antikörper

Target: KHDRBS2 (KH Domain Containing, RNA Binding, Signal Transduction Associated 2 (KHDRBS2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KHDRBS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KHDRBS2 antibody was raised against the middle region of KHDRBS2

Aufreinigung: Affinity purified

Immunogen: KHDRBS2 antibody was raised using the middle region of KHDRBS2 corresponding to a region with amino acids EAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KHDRBS2 Blocking Peptide, catalog no. 33R-2292, is also available for use as a blocking control in assays to test for specificity of this KHDRBS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHDRBS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KHDRBS2

Target: KHDRBS2 (KH Domain Containing, RNA Binding, Signal Transduction Associated 2 (KHDRBS2))

Andere Bezeichnung: KHDRBS2 (KHDRBS2 Produkte)

Synonyme: slm1 antikoerper, slm-1 antikoerper, MGC145973 antikoerper, ba535f17.1 antikoerper, zgc:153588 antikoerper, SLM-1 antikoerper, SLM1 antikoerper, bA535F17.1 antikoerper, 6330586C16Rik antikoerper, Slim1 antikoerper, Slm1 antikoerper, KH RNA binding domain containing, signal transduction associated 2 antikoerper, KH domain containing, RNA binding, signal transduction associated 2 antikoerper, KHDRBS2 antikoerper, khdrbs2 antikoerper, Khdrbs2 antikoerper

Hintergrund: KHDRBS2 is a RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. Its phosphorylation by FYN inhibits its ability to regulate splice site selection.

Molekulargewicht: 39 kDa (MW of target protein)