Nodal Antikörper
-
- Target Alle Nodal (NODAL) Antikörper anzeigen
- Nodal (NODAL) (Nodal Homolog (NODAL))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Nodal Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NODAL antibody was raised using a synthetic peptide corresponding to a region with amino acids PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ
- Top Product
- Discover our top product NODAL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NODAL Blocking Peptide, catalog no. 33R-7373, is also available for use as a blocking control in assays to test for specificity of this NODAL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NODAL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nodal (NODAL) (Nodal Homolog (NODAL))
- Andere Bezeichnung
- NODAL (NODAL Produkte)
- Synonyme
- NODAL antikoerper, Tg.413d antikoerper, HTX5 antikoerper, nodal4 antikoerper, nodal4-A antikoerper, nr4 antikoerper, xnr4 antikoerper, Xnr-1 antikoerper, nodal antikoerper, nr1 antikoerper, nr1-A antikoerper, nodal growth differentiation factor antikoerper, nodal homolog (mouse) antikoerper, nodal antikoerper, nodal growth differentiation factor L homeolog antikoerper, nodal homolog 1 L homeolog antikoerper, Nodal antikoerper, NODAL antikoerper, nodal.L antikoerper, nodal1.L antikoerper
- Hintergrund
- The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Stem Cell Maintenance, Tube Formation, Positive Regulation of Endopeptidase Activity
-