APOH Antikörper

Produktnummer ABIN631792

Produktdetails anti-APOH Antikörper

Target: APOH (Apolipoprotein H (Beta-2-Glycoprotein I) (APOH))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APOH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ApoH Blocking Peptide, catalog no. 33R-7270, is also available for use as a blocking control in assays to test for specificity of this ApoH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APOH

Target: APOH (Apolipoprotein H (Beta-2-Glycoprotein I) (APOH))

Andere Bezeichnung: ApoH (APOH Produkte)

Synonyme: B2G1 antikoerper, B2GP1 antikoerper, BG antikoerper, BETA2 antikoerper, BHF-1 antikoerper, MODY6 antikoerper, NEUROD antikoerper, bHLHa3 antikoerper, apoh antikoerper, APOH antikoerper, B2GPI antikoerper, beta-2-GPI antikoerper, beta2-GPI antikoerper, LOC100227913 antikoerper, apolipoprotein H antikoerper, neuronal differentiation 1 antikoerper, APOH antikoerper, NEUROD1 antikoerper, apoh antikoerper, Apoh antikoerper

Hintergrund: Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies.

Molekulargewicht: 36 kDa (MW of target protein)