PAFAH1B2 Antikörper (N-Term)
-
- Target Alle PAFAH1B2 Antikörper anzeigen
- PAFAH1B2 (Platelet-Activating Factor Acetylhydrolase 1b, Catalytic Subunit 2 (30kDa) (PAFAH1B2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PAFAH1B2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PAFAH1 B2 antibody was raised against the N terminal of PAFAH1 2
- Aufreinigung
- Affinity purified
- Immunogen
- PAFAH1 B2 antibody was raised using the N terminal of PAFAH1 2 corresponding to a region with amino acids MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMV
- Top Product
- Discover our top product PAFAH1B2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PAFAH1B2 Blocking Peptide, catalog no. 33R-6478, is also available for use as a blocking control in assays to test for specificity of this PAFAH1B2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAFAH0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAFAH1B2 (Platelet-Activating Factor Acetylhydrolase 1b, Catalytic Subunit 2 (30kDa) (PAFAH1B2))
- Andere Bezeichnung
- PAFAH1B2 (PAFAH1B2 Produkte)
- Synonyme
- si:ch211-139a5.3 antikoerper, PAFAHB antikoerper, AI747451 antikoerper, AU021353 antikoerper, Pafahb antikoerper, mus[b] antikoerper, platelet activating factor acetylhydrolase 1b catalytic subunit 2 antikoerper, platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) antikoerper, platelet activating factor acetylhydrolase 1b catalytic subunit 2 L homeolog antikoerper, platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 antikoerper, platelet-activating factor acetylhydrolase, isoform 1b, subunit 2 antikoerper, PAFAH1B2 antikoerper, pafah1b2.L antikoerper, pafah1b2 antikoerper, Pafah1b2 antikoerper
- Hintergrund
- Platelet-activating factor acetylhydrolase (PAFAH) inactivates platelet-activating factor (PAF) into acetate and LYSO-PAF.
- Molekulargewicht
- 25 kDa (MW of target protein)
-