HSD17B1 Antikörper
-
- Target Alle HSD17B1 Antikörper anzeigen
- HSD17B1 (Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HSD17B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- HSD17 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA
- Top Product
- Discover our top product HSD17B1 Primärantikörper
-
anti-Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1) (AA 189-285) antibody
HSD17B1 Reaktivität: Human WB, ELISA, IHC (p) Wirt: Maus Monoclonal 2E5 unconjugated
anti-Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1) (AA 1-328) antibodyHSD17B1 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1) (AA 29-43), (N-Term) antibodyHSD17B1 Reaktivität: Human, Ratte WB, ICC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1) (AA 29-43) antibodyHSD17B1 Reaktivität: Human, Ratte, Maus WB, ICC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1) antibodyHSD17B1 Reaktivität: Human, Ratte, Maus IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1) (AA 4-289) antibodyHSD17B1 Reaktivität: Human WB, IHC, ICC, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1) (AA 2-261) antibodyHSD17B1 Reaktivität: Human WB, ELISA, IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1) (AA 268-328) antibodyHSD17B1 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1) (AA 21-120) antibodyHSD17B1 Reaktivität: Human, Maus WB, ELISA, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1) antibodyHSD17B1 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HSD17B1 Blocking Peptide, catalog no. 33R-5737, is also available for use as a blocking control in assays to test for specificity of this HSD17B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HSD17B1 (Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1))
- Andere Bezeichnung
- HSD17B1 (HSD17B1 Produkte)
- Synonyme
- EDH17B2 antikoerper, EDHB17 antikoerper, HSD17 antikoerper, SDR28C1 antikoerper, 17HSDB1 antikoerper, 17beta-HSD antikoerper, E2DH antikoerper, Hsd17ba antikoerper, 17BHD1 antikoerper, zfHSD17B1 antikoerper, hydroxysteroid 17-beta dehydrogenase 1 antikoerper, hydroxysteroid (17-beta) dehydrogenase 1 antikoerper, HSD17B1 antikoerper, Hsd17b1 antikoerper, hsd17b1 antikoerper
- Hintergrund
- HSD17B1 is favors the reduction of estrogens and androgens. It also has 20-alpha-HSD activity. It uses preferentially NADH.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis
-
