TNP1 Antikörper

Produktnummer ABIN631745

Der Kaninchen Polyklonal anti-TNP1 Antikörper wird verwendet zum Nachweis von TNP1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für TNP1 Antikörper (ABIN631745)

Target: TNP1 (Transition Protein 1 (During Histone To Protamine Replacement) (TNP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TNP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TNP1 Antikörper

Aufreinigung: Affinity purified

Immunogen: TNP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TNP1 Blocking Peptide, (ABIN5616719), is also available for use as a blocking control in assays to test for specificity of this TNP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TNP1

Target: TNP1 (Transition Protein 1 (During Histone To Protamine Replacement) (TNP1))

Andere Bezeichnung: TNP1

Hintergrund: TNP1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines.

Molekulargewicht: 6 kDa (MW of target protein)