TNP1 Antikörper
-
- Target Alle TNP1 Antikörper anzeigen
- TNP1 (Transition Protein 1 (During Histone To Protamine Replacement) (TNP1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TNP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TNP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN
- Top Product
- Discover our top product TNP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TNP1 Blocking Peptide, catalog no. 33R-6520, is also available for use as a blocking control in assays to test for specificity of this TNP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNP1 (Transition Protein 1 (During Histone To Protamine Replacement) (TNP1))
- Andere Bezeichnung
- TNP1 (TNP1 Produkte)
- Synonyme
- TNP1 antikoerper, TP1 antikoerper, Stp-1 antikoerper, Tp-1 antikoerper, STP-1 antikoerper, TP-1 antikoerper, transition protein 1 antikoerper, TNP1 antikoerper, Tnp1 antikoerper
- Hintergrund
- TNP1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines.
- Molekulargewicht
- 6 kDa (MW of target protein)
-