TSR1 Antikörper

Produktnummer ABIN631738

Produktdetails anti-TSR1 Antikörper

Target: TSR1 (TSR1, 20S rRNA Accumulation, Homolog (TSR1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TSR1 Blocking Peptide, catalog no. 33R-5698, is also available for use as a blocking control in assays to test for specificity of this TSR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSR1

Target: TSR1 (TSR1, 20S rRNA Accumulation, Homolog (TSR1))

Andere Bezeichnung: TSR1 (TSR1 Produkte)

Synonyme: AU040765 antikoerper, AW550801 antikoerper, mKIAA1401 antikoerper, TSR1 20S rRNA accumulation antikoerper, TSR1, ribosome maturation factor L homeolog antikoerper, TSR1, ribosome maturation factor antikoerper, Tsr1 antikoerper, tsr1.L antikoerper, TSR1 antikoerper

Hintergrund: TSR1 belongs to the BMS1/TSR1 family and TSR1 subfamily. TSR1 is required during maturation of the 40S ribosomal subunit in the nucleolus.

Molekulargewicht: 92 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly