-
- Target Alle RABGEF1 Antikörper anzeigen
- RABGEF1 (RAB Guanine Nucleotide Exchange Factor (GEF) 1 (RABGEF1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RABGEF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RABGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ
- Top Product
- Discover our top product RABGEF1 Primärantikörper
-
anti-RAB Guanine Nucleotide Exchange Factor (GEF) 1 (RABGEF1) (AA 1-491) antibody
RABGEF1 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-RAB Guanine Nucleotide Exchange Factor (GEF) 1 (RABGEF1) (AA 1-491) antibodyRABGEF1 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-RAB Guanine Nucleotide Exchange Factor (GEF) 1 (RABGEF1) (N-Term) antibodyRABGEF1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Huhn, Zebrafisch (Danio rerio), Ziege, Meerschweinchen, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-RAB Guanine Nucleotide Exchange Factor (GEF) 1 (RABGEF1) (C-Term) antibodyRABGEF1 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-RAB Guanine Nucleotide Exchange Factor (GEF) 1 (RABGEF1) (N-Term) antibodyRABGEF1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Zebrafisch (Danio rerio), Ziege, Kaninchen, Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RABGEF1 Blocking Peptide, catalog no. 33R-6460, is also available for use as a blocking control in assays to test for specificity of this RABGEF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABGEF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RABGEF1 (RAB Guanine Nucleotide Exchange Factor (GEF) 1 (RABGEF1))
- Andere Bezeichnung
- RABGEF1 (RABGEF1 Produkte)
- Synonyme
- Rab5ef antikoerper, Rabex5 antikoerper, Rin2 antikoerper, RABEX5 antikoerper, rabex-5 antikoerper, rabgef1 antikoerper, RAB guanine nucleotide exchange factor (GEF) 1 antikoerper, RAB guanine nucleotide exchange factor 1 antikoerper, RAB guanine nucleotide exchange factor (GEF) 1 L homeolog antikoerper, Rabgef1 antikoerper, RABGEF1 antikoerper, rabgef1.L antikoerper
- Hintergrund
- RABGEF1 forms a complex with rabaptin-5 that is required for endocytic membrane fusion, and it serves as a specific guanine nucleotide exchange factor (GEF) for RAB5.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
-
Sie sind hier:
