F-Box Protein 27 (FBXO27) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN631723
  • MGC145578
  • FBG5
  • Fbx27
  • E130008B10Rik
  • Gm161
  • F-box protein 27 S homeolog
  • F-box protein 27
  • fbxo27.S
  • fbxo27
  • FBXO27
  • Fbxo27
Middle Region
Western Blotting (WB)
Immunogen FBXO27 antibody was raised using the middle region of FBXO27 corresponding to a region with amino acids LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAG
Spezifität FBXO27 antibody was raised against the middle region of FBXO27
Reinigung Affinity purified
Andere Bezeichnung FBXO27 (FBXO27 Antibody Abstract)
Hintergrund Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
Molekulargewicht 31 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

FBXO27 Blocking Peptide, catalog no. 33R-4851, is also available for use as a blocking control in assays to test for specificity of this FBXO27 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO27 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Western Blotting (WB) image for anti-F-Box Protein 27 (FBXO27) (Middle Region) antibody (ABIN631723) FBXO27 antibody used at 1 ug/ml to detect target protein.
Haben Sie etwas anderes gesucht?