FBXO27 Antikörper (Middle Region)

Produktnummer ABIN631723

Produktdetails anti-FBXO27 Antikörper

Target: FBXO27 (F-Box Protein 27 (FBXO27))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXO27 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXO27 antibody was raised against the middle region of FBXO27

Aufreinigung: Affinity purified

Immunogen: FBXO27 antibody was raised using the middle region of FBXO27 corresponding to a region with amino acids LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXO27 Blocking Peptide, catalog no. 33R-4851, is also available for use as a blocking control in assays to test for specificity of this FBXO27 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO27 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXO27

Target: FBXO27 (F-Box Protein 27 (FBXO27))

Andere Bezeichnung: FBXO27 (FBXO27 Produkte)

Synonyme: MGC145578 antikoerper, FBG5 antikoerper, Fbx27 antikoerper, E130008B10Rik antikoerper, Gm161 antikoerper, F-box protein 27 S homeolog antikoerper, F-box protein 27 antikoerper, fbxo27.S antikoerper, fbxo27 antikoerper, FBXO27 antikoerper, Fbxo27 antikoerper

Hintergrund: Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molekulargewicht: 31 kDa (MW of target protein)