GNB2 Antikörper

Produktnummer ABIN631706

Produktdetails anti-GNB2 Antikörper

Target: GNB2 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 2 (GNB2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNB2 Blocking Peptide, catalog no. 33R-1656, is also available for use as a blocking control in assays to test for specificity of this GNB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNB2

Target: GNB2 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 2 (GNB2))

Andere Bezeichnung: GNB2 (GNB2 Produkte)

Synonyme: XGB1 antikoerper, XGbeta1 antikoerper, gnb2 antikoerper, Gnb-2 antikoerper, im:7138539 antikoerper, zgc:113357 antikoerper, guanine nucleotide binding protein (G protein), beta polypeptide 1 antikoerper, G protein subunit beta 2 antikoerper, guanine nucleotide binding protein (G protein), beta 2 antikoerper, guanine nucleotide binding protein (G protein), beta polypeptide 2 antikoerper, gnb1 antikoerper, GNB2 antikoerper, Gnb2 antikoerper, gnb2 antikoerper

Hintergrund: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB2 is a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction