GNB2 Antikörper
-
- Target Alle GNB2 Antikörper anzeigen
- GNB2 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 2 (GNB2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GNB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR
- Top Product
- Discover our top product GNB2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GNB2 Blocking Peptide, catalog no. 33R-1656, is also available for use as a blocking control in assays to test for specificity of this GNB2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNB2 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 2 (GNB2))
- Andere Bezeichnung
- GNB2 (GNB2 Produkte)
- Synonyme
- XGB1 antikoerper, XGbeta1 antikoerper, gnb2 antikoerper, Gnb-2 antikoerper, im:7138539 antikoerper, zgc:113357 antikoerper, guanine nucleotide binding protein (G protein), beta polypeptide 1 antikoerper, G protein subunit beta 2 antikoerper, guanine nucleotide binding protein (G protein), beta 2 antikoerper, guanine nucleotide binding protein (G protein), beta polypeptide 2 antikoerper, gnb1 antikoerper, GNB2 antikoerper, Gnb2 antikoerper, gnb2 antikoerper
- Hintergrund
- Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB2 is a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction
-