PES1 Antikörper

Produktnummer ABIN631680

Produktdetails anti-PES1 Antikörper

Target: PES1 (Pescadillo Ribosomal Biogenesis Factor 1 (PES1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PES1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PES1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKREKYLYQKIMFGKRRKIREANKLAEKRKAHDEAVRSEKKAKKARPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PES1 Blocking Peptide, catalog no. 33R-4489, is also available for use as a blocking control in assays to test for specificity of this PES1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PES1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PES1

Target: PES1 (Pescadillo Ribosomal Biogenesis Factor 1 (PES1))

Andere Bezeichnung: PES1 (PES1 Produkte)

Synonyme: PES antikoerper, pes antikoerper, pes1 antikoerper, pescadillo ribosomal biogenesis factor 1 antikoerper, pescadillo ribosomal biogenesis factor 1 S homeolog antikoerper, Pescadillo antikoerper, PES1 antikoerper, Pes1 antikoerper, pes1.S antikoerper, pesc antikoerper

Hintergrund: PES1 is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression.

Molekulargewicht: 68 kDa (MW of target protein)