CEACAM6 Antikörper
-
- Target Alle CEACAM6 Antikörper anzeigen
- CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CEACAM6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI
- Top Product
- Discover our top product CEACAM6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CEACAM6 Blocking Peptide, catalog no. 33R-4544, is also available for use as a blocking control in assays to test for specificity of this CEACAM6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))
- Andere Bezeichnung
- CEACAM6 (CEACAM6 Produkte)
- Synonyme
- CD66c antikoerper, CEAL antikoerper, NCA antikoerper, carcinoembryonic antigen-related cell adhesion molecule 6 antikoerper, carcinoembryonic antigen related cell adhesion molecule 6 antikoerper, Ceacam6 antikoerper, CEACAM6 antikoerper
- Hintergrund
- Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo.
- Molekulargewicht
- 33 kDa (MW of target protein)
-