CEACAM6 Antikörper

Produktnummer ABIN631672

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CEACAM6 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für CEACAM6 Antikörper (ABIN631672)

Target: CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CEACAM6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CEACAM6 Antikörper

Aufreinigung: Affinity purified

Immunogen: CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CEACAM6 Blocking Peptide, (ABIN939930), is also available for use as a blocking control in assays to test for specificity of this CEACAM6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CEACAM6

Target: CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))

Andere Bezeichnung: CEACAM6

Hintergrund: Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo.

Molekulargewicht: 33 kDa (MW of target protein)