ACTN1 Antikörper (N-Term)

Produktnummer ABIN631669

Produktdetails anti-ACTN1 Antikörper

Target: ACTN1 (Actinin, alpha 1 (ACTN1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Alpha Actinin 1 antibody was raised against the N terminal of ACTN1

Aufreinigung: Affinity purified

Immunogen: alpha Actinin 1 antibody was raised using the N terminal of ACTN1 corresponding to a region with amino acids DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Alpha Actinin 1 Blocking Peptide, catalog no. 33R-1985, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACTN1

Target: ACTN1 (Actinin, alpha 1 (ACTN1))

Andere Bezeichnung: alpha Actinin 1 (ACTN1 Produkte)

Synonyme: ACTN1 antikoerper, actinin antikoerper, BDPLT15 antikoerper, 3110023F10Rik antikoerper, Actn1a antikoerper, actinin alpha 1 antikoerper, actinin, alpha 1 antikoerper, actinin alpha 1 L homeolog antikoerper, ACTN1 antikoerper, actn1 antikoerper, Actn1 antikoerper, actn1.L antikoerper

Hintergrund: Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments.

Molekulargewicht: 103 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization