G2E3 Antikörper (N-Term)

Produktnummer ABIN631665

Produktdetails anti-G2E3 Antikörper

Target: G2E3 (G2/M-Phase Specific E3 Ubiquitin Protein Ligase (G2E3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser G2E3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIAA1333 antibody was raised against the N terminal of KIAA1333

Aufreinigung: Affinity purified

Immunogen: KIAA1333 antibody was raised using the N terminal of KIAA1333 corresponding to a region with amino acids IWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA1333 Blocking Peptide, catalog no. 33R-4215, is also available for use as a blocking control in assays to test for specificity of this KIAA1333 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1333 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu G2E3

Target: G2E3 (G2/M-Phase Specific E3 Ubiquitin Protein Ligase (G2E3))

Andere Bezeichnung: KIAA1333 (G2E3 Produkte)

Synonyme: KIAA1333 antikoerper, PHF7B antikoerper, sb:cb726 antikoerper, si:busm1-234g15.1 antikoerper, si:dz234g15.1 antikoerper, wu:fe02a06 antikoerper, wu:fe24c12 antikoerper, 6030408C04Rik antikoerper, 9030416F18 antikoerper, AW046379 antikoerper, D930034K21Rik antikoerper, mKIAA1333 antikoerper, RGD1310263 antikoerper, G2/M-phase specific E3 ubiquitin protein ligase antikoerper, G2/M-phase specific E3 ubiquitin ligase antikoerper, G2E3 antikoerper, g2e3 antikoerper, G2e3 antikoerper

Hintergrund: KIAA1333 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Molekulargewicht: 80 kDa (MW of target protein)