VPS8 Antikörper

Produktnummer ABIN631659

Produktdetails anti-VPS8 Antikörper

Target: VPS8 (Vacuolar Protein Sorting 8 Homolog (VPS8))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VPS8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: VPS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGFAKGQITMWDLASGKLLRSITDAHPPGTAILHIKFTDDPTLAICNDSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VPS8 Blocking Peptide, catalog no. 33R-1696, is also available for use as a blocking control in assays to test for specificity of this VPS8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VPS8

Target: VPS8 (Vacuolar Protein Sorting 8 Homolog (VPS8))

Andere Bezeichnung: VPS8 (VPS8 Produkte)

Synonyme: si:dkey-24b15.1 antikoerper, zgc:158695 antikoerper, KIAA0804 antikoerper, AI315068 antikoerper, AU040738 antikoerper, mKIAA0804 antikoerper, RGD1309443 antikoerper, VPS8, CORVET complex subunit antikoerper, vacuolar protein sorting 8 homolog (S. cerevisiae) antikoerper, VPS8 CORVET complex subunit antikoerper, vps8 antikoerper, VPS8 antikoerper, Vps8 antikoerper

Hintergrund: VPS8 belongs to the VPS8 family. It contains 1 RING-type zinc finger and 1 WD repeat. The functions of VPS8 remain unknown.

Molekulargewicht: 162 kDa (MW of target protein)