ANP32B Antikörper

Produktnummer ABIN631639

Produktdetails anti-ANP32B Antikörper

Target: ANP32B (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member B (ANP32B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANP32B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ANP32 B antibody was raised using a synthetic peptide corresponding to a region with amino acids GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANP32B Blocking Peptide, catalog no. 33R-3427, is also available for use as a blocking control in assays to test for specificity of this ANP32B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANP30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANP32B

Target: ANP32B (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member B (ANP32B))

Andere Bezeichnung: ANP32B (ANP32B Produkte)

Synonyme: APRIL antikoerper, PHAPI2 antikoerper, SSP29 antikoerper, 2410015B15Rik antikoerper, PAL31 antikoerper, PHAPI2a antikoerper, Ssp29 antikoerper, cb908 antikoerper, fa99a11 antikoerper, wu:fa28c10 antikoerper, wu:fa99a11 antikoerper, wu:fb40e12 antikoerper, zgc:77745 antikoerper, hLAMP-1 antikoerper, MGC80871 antikoerper, ANP32B antikoerper, MGC69373 antikoerper, SLAN antikoerper, acidic nuclear phosphoprotein 32 family member B antikoerper, acidic (leucine-rich) nuclear phosphoprotein 32 family, member B antikoerper, acidic nuclear phosphoprotein 32 family member B L homeolog antikoerper, acidic leucine-rich nuclear phosphoprotein 32 family member B antikoerper, ANP32B antikoerper, Anp32b antikoerper, anp32b antikoerper, anp32b.L antikoerper, LOC494442 antikoerper

Hintergrund: ANP32B is a multifunctional protein working as a cell cycle progression factor as well as a cell survival factor. ANP32B is required for the progression from the G1 to the S phase. ANP32B is an anti-apoptotic protein which functions as a caspase-3 inhibitor. It has no phosphatase 2A (PP2A) inhibitor activity.

Molekulargewicht: 29 kDa (MW of target protein)