CHN2 Antikörper
-
- Target Alle CHN2 Antikörper anzeigen
- CHN2 (Chimerin (Chimaerin) 2 (CHN2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHN2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CHN2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC
- Top Product
- Discover our top product CHN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHN2 Blocking Peptide, catalog no. 33R-6714, is also available for use as a blocking control in assays to test for specificity of this CHN2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHN2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHN2 (Chimerin (Chimaerin) 2 (CHN2))
- Andere Bezeichnung
- CHN2 (CHN2 Produkte)
- Synonyme
- 1700026N20Rik antikoerper, 4930557O16Rik antikoerper, ARHGAP3 antikoerper, Bch antikoerper, BCH antikoerper, CHN2-3 antikoerper, RHOGAP3 antikoerper, chimerin 2 antikoerper, chimerin 2 L homeolog antikoerper, chn2 antikoerper, CHN2 antikoerper, Chn2 antikoerper, chn2.L antikoerper
- Hintergrund
- CHN2 is a protein with a phorbol-ester/DAG-type zinc finger, a Rho-GAP domain and an SH2 domain. This protein has GTPase-activating protein activity that is regulated by phospholipid binding and binding of diacylglycerol (DAG) induces translocation of the protein from the cytosol to the Golgi apparatus membrane. CHN2 plays a role in the proliferation and migration of smooth muscle cells. Decreased expression of this gene is associated with high-grade gliomas and breast tumors, and increased expression of this gene is associated with lymphomas. Mutations in this gene have been associated with schizophrenia in men.
- Molekulargewicht
- 38 kDa (MW of target protein)
-