RNF6 Antikörper

Produktnummer ABIN631636

Produktdetails anti-RNF6 Antikörper

Target: RNF6 (RING Finger Protein 6 (RNF6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RNF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETGTLPILRLAHFFLLNESDDDDRIRGLTKEQIDNLSTRHYEHNSIDSE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF6 Blocking Peptide, catalog no. 33R-9514, is also available for use as a blocking control in assays to test for specificity of this RNF6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF6

Target: RNF6 (RING Finger Protein 6 (RNF6))

Andere Bezeichnung: RNF6 (RNF6 Produkte)

Synonyme: 1200013I08Rik antikoerper, 5730419H05Rik antikoerper, AA537053 antikoerper, ring finger protein 6 antikoerper, ring finger protein (C3H2C3 type) 6 antikoerper, RNF6 antikoerper, Rnf6 antikoerper

Hintergrund: RNF6 contains a RING-H2 finger motif. Deletions and mutations in this gene were detected in esophageal squamous cell carcinoma (ESCC), suggesting that this protein may be a potential tumor suppressor. Studies of the mouse counterpart suggested a role of this protein in the transcription regulation that controls germinal differentiation.

Molekulargewicht: 78 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Regulation of Cell Size