RBBP7 Antikörper (Middle Region)
-
- Target Alle RBBP7 Antikörper anzeigen
- RBBP7 (Retinoblastoma Binding Protein 7 (RBBP7))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RBBP7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RBBP7 antibody was raised against the middle region of RBBP7
- Aufreinigung
- Affinity purified
- Immunogen
- RBBP7 antibody was raised using the middle region of RBBP7 corresponding to a region with amino acids HWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH
- Top Product
- Discover our top product RBBP7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RBBP7 Blocking Peptide, catalog no. 33R-3875, is also available for use as a blocking control in assays to test for specificity of this RBBP7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBBP7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBBP7 (Retinoblastoma Binding Protein 7 (RBBP7))
- Andere Bezeichnung
- RBBP7 (RBBP7 Produkte)
- Synonyme
- RbAp46 antikoerper, AA409861 antikoerper, AI173248 antikoerper, AU019541 antikoerper, BB114024 antikoerper, mRbAp46 antikoerper, rbap46 antikoerper, RBBP7 antikoerper, RBBP-7 antikoerper, Caf1 antikoerper, rbbp7 antikoerper, wu:fa13g08 antikoerper, wu:fb50h10 antikoerper, wu:fc29d09 antikoerper, zgc:56477 antikoerper, zgc:85617 antikoerper, CaO19.2146 antikoerper, RB binding protein 7, chromatin remodeling factor antikoerper, retinoblastoma binding protein 7, chromatin remodeling factor antikoerper, retinoblastoma binding protein 7 L homeolog antikoerper, retinoblastoma binding protein 7 antikoerper, retinoblastoma binding protein 4, like antikoerper, histone-binding protein RBBP7 antikoerper, Hat2p antikoerper, RBBP7 antikoerper, Rbbp7 antikoerper, rbbp7.L antikoerper, rbbp7 antikoerper, rbb4l antikoerper, LOC108708306 antikoerper, HAT2 antikoerper
- Hintergrund
- This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation.
- Molekulargewicht
- 48 kDa (MW of target protein)
-