Nucleostemin Antikörper
-
- Target Alle Nucleostemin (GNL3) Antikörper anzeigen
- Nucleostemin (GNL3) (Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Nucleostemin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GNL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR
- Top Product
- Discover our top product GNL3 Primärantikörper
-
anti-Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3) (AA 1-226) antibody
GNL3 Reaktivität: Human, Maus WB, ELISA, FACS Wirt: Maus Monoclonal 2C8D5 unconjugated
anti-Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3) (AA 1-226) antibodyGNL3 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2C8D5 unconjugated
anti-Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3) (AA 1-549) antibodyGNL3 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3) antibodyGNL3 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3) (AA 328-427) antibodyGNL3 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1A1 unconjugated
anti-Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3) (AA 465-495) antibodyGNL3 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3) (AA 1-240) antibodyGNL3 Reaktivität: Human WB, IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3) (AA 91-124), (N-Term) antibodyGNL3 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal RB51601 unconjugated
anti-Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3) (AA 442-471), (C-Term) antibodyGNL3 Reaktivität: Maus WB Wirt: Kaninchen Polyclonal RB40720 unconjugated
anti-Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3) (AA 458-487), (C-Term) antibodyGNL3 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB13446 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GNL3 Blocking Peptide, catalog no. 33R-6534, is also available for use as a blocking control in assays to test for specificity of this GNL3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNL3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nucleostemin (GNL3) (Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3))
- Andere Bezeichnung
- GNL3 (GNL3 Produkte)
- Synonyme
- id:ibd2914 antikoerper, nstm antikoerper, wu:fb38a04 antikoerper, wu:fc55d07 antikoerper, zgc:123093 antikoerper, e2ig3 antikoerper, C77032 antikoerper, E2IG3 antikoerper, NNP47 antikoerper, NS antikoerper, BC037996 antikoerper, Ns antikoerper, guanine nucleotide binding protein-like 3 (nucleolar) antikoerper, G protein nucleolar 3 antikoerper, guanine nucleotide binding protein-like 3 (nucleolar) L homeolog antikoerper, gnl3 antikoerper, GNL3 antikoerper, Gnl3 antikoerper, gnl3.L antikoerper
- Hintergrund
- GNL3 may be required to maintain the proliferative capacity of stem cells and may play an important role in tumorigenesis.
- Molekulargewicht
- 60 kDa (MW of target protein)
-
