PDAP1 Antikörper (N-Term)
-
- Target Alle PDAP1 Antikörper anzeigen
- PDAP1 (PDGFA Associated Protein 1 (PDAP1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PDAP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PDAP1 antibody was raised against the N terminal of PDAP1
- Aufreinigung
- Affinity purified
- Immunogen
- PDAP1 antibody was raised using the N terminal of PDAP1 corresponding to a region with amino acids MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD
- Top Product
- Discover our top product PDAP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PDAP1 Blocking Peptide, catalog no. 33R-6287, is also available for use as a blocking control in assays to test for specificity of this PDAP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDAP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDAP1 (PDGFA Associated Protein 1 (PDAP1))
- Andere Bezeichnung
- PDAP1 (PDAP1 Produkte)
- Synonyme
- pdap1 antikoerper, zgc:56213 antikoerper, HASPP28 antikoerper, PAP antikoerper, PAP1 antikoerper, Haspp28 antikoerper, pdgfa associated protein 1b antikoerper, 28 kDa heat- and acid-stable phosphoprotein antikoerper, PDGFA associated protein 1 antikoerper, pdap1b antikoerper, CpipJ_CPIJ013582 antikoerper, PDAP1 antikoerper, Pdap1 antikoerper
- Hintergrund
- PDAP1 enhances PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB.
- Molekulargewicht
- 20 kDa (MW of target protein)
- Pathways
- Platelet-derived growth Factor Receptor Signaling
-