NRD1 Antikörper

Produktnummer ABIN631610

Produktdetails anti-NRD1 Antikörper

Target: NRD1 (Nardilysin (N-Arginine Dibasic Convertase) (NRD1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NRD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: NRD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NRD1 Blocking Peptide, catalog no. 33R-3570, is also available for use as a blocking control in assays to test for specificity of this NRD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NRD1

Target: NRD1 (Nardilysin (N-Arginine Dibasic Convertase) (NRD1))

Andere Bezeichnung: NRD1 (NRD1 Produkte)

Synonyme: hNRD1 antikoerper, hNRD2 antikoerper, NRDC antikoerper, 2600011I06Rik antikoerper, AI875733 antikoerper, NRD-C antikoerper, NRD1 antikoerper, si:dkey-171o17.4 antikoerper, DKFZp459N143 antikoerper, nardilysin convertase antikoerper, nardilysin, N-arginine dibasic convertase, NRD convertase 1 antikoerper, nardilysin antikoerper, nardilysin b (N-arginine dibasic convertase) antikoerper, NRDC antikoerper, Nrdc antikoerper, Nrd1 antikoerper, LOC552055 antikoerper, nrd1b antikoerper, CpipJ_CPIJ002524 antikoerper, Tsp_03755 antikoerper

Hintergrund: NRD1 cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.

Molekulargewicht: 132 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development