TRMT2B Antikörper (N-Term)
-
- Target Alle TRMT2B Antikörper anzeigen
- TRMT2B (tRNA Methyltransferase 2 Homolog B (TRMT2B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRMT2B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CXORF34 antibody was raised against the N terminal Of Cxorf34
- Aufreinigung
- Affinity purified
- Immunogen
- CXORF34 antibody was raised using the N terminal Of Cxorf34 corresponding to a region with amino acids PPGWSQLFLGTVCKGDFTRVIATKCQKGQKSQKKPSHLGPLDGSWQERLA
- Top Product
- Discover our top product TRMT2B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CXORF34 Blocking Peptide, catalog no. 33R-7256, is also available for use as a blocking control in assays to test for specificity of this CXORF34 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF34 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRMT2B (tRNA Methyltransferase 2 Homolog B (TRMT2B))
- Andere Bezeichnung
- CXORF34 (TRMT2B Produkte)
- Synonyme
- CXorf34 antikoerper, dJ341D10.3 antikoerper, 4732479N06Rik antikoerper, im:7160396 antikoerper, wu:fc49d02 antikoerper, zgc:162982 antikoerper, tRNA methyltransferase 2 homolog B antikoerper, TRM2 tRNA methyltransferase 2B antikoerper, TRMT2B antikoerper, Trmt2b antikoerper, trmt2b antikoerper
- Hintergrund
- TRMT2B (CXorf34) is probable S-adenosyl-L-methionine-dependent methlytransferase that catalyzes the formation of 5-methyl-uridine at position 54 (M-5-U54) in all tRNA. And it may also have a role in tRNA stabilization or maturation.
- Molekulargewicht
- 56 kDa (MW of target protein)
-