METTL2B Antikörper (N-Term)
-
- Target Alle METTL2B Antikörper anzeigen
- METTL2B (Methyltransferase Like 2B (METTL2B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser METTL2B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- METTL2 B antibody was raised against the N terminal of METTL2
- Aufreinigung
- Affinity purified
- Immunogen
- METTL2 B antibody was raised using the N terminal of METTL2 corresponding to a region with amino acids INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS
- Top Product
- Discover our top product METTL2B Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
METTL2B Blocking Peptide, catalog no. 33R-4070, is also available for use as a blocking control in assays to test for specificity of this METTL2B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- METTL2B (Methyltransferase Like 2B (METTL2B))
- Andere Bezeichnung
- METTL2B (METTL2B Produkte)
- Synonyme
- METL antikoerper, METTL2 antikoerper, METTL2A antikoerper, PSENIP1 antikoerper, Mettl2 antikoerper, methyltransferase like 2B antikoerper, METTL2B antikoerper, Mettl2b antikoerper
- Hintergrund
- METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases.
- Molekulargewicht
- 43 kDa (MW of target protein)
-