SCP2 Antikörper (Middle Region)

Produktnummer ABIN631588

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SCP2 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Ratte.

Kurzübersicht für SCP2 Antikörper (Middle Region) (ABIN631588)

Target: SCP2 (Sterol Carrier Protein 2 (SCP2))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SCP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SCP2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SCP2 antibody was raised against the middle region of SCP2

Aufreinigung: Affinity purified

Immunogen: SCP2 antibody was raised using the middle region of SCP2 corresponding to a region with amino acids NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SCP2 Blocking Peptide, (ABIN5616017), is also available for use as a blocking control in assays to test for specificity of this SCP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SCP2

Target: SCP2 (Sterol Carrier Protein 2 (SCP2))

Andere Bezeichnung: SCP2

Hintergrund: SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process