SCP2 Antikörper (Middle Region)

Produktnummer ABIN631588

Produktdetails anti-SCP2 Antikörper

Target: SCP2 (Sterol Carrier Protein 2 (SCP2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SCP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SCP2 antibody was raised against the middle region of SCP2

Aufreinigung: Affinity purified

Immunogen: SCP2 antibody was raised using the middle region of SCP2 corresponding to a region with amino acids NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SCP2 Blocking Peptide, catalog no. 33R-6715, is also available for use as a blocking control in assays to test for specificity of this SCP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SCP2

Target: SCP2 (Sterol Carrier Protein 2 (SCP2))

Andere Bezeichnung: SCP2 (SCP2 Produkte)

Synonyme: NLTP antikoerper, NSL-TP antikoerper, SCP-2 antikoerper, SCP-CHI antikoerper, SCP-X antikoerper, SCPX antikoerper, AA409774 antikoerper, AA409893 antikoerper, C76618 antikoerper, C79031 antikoerper, ns-LTP antikoerper, NSLIPTR antikoerper, SCPx antikoerper, MGC77634 antikoerper, zgc:77634 antikoerper, SCP2 antikoerper, MGC108409 antikoerper, ATSCP2 antikoerper, MBD2.8 antikoerper, MBD2_8 antikoerper, STEROL CARRIER PROTEIN 2 antikoerper, PLTP antikoerper, zgc:101621 antikoerper, sterol carrier protein 2 antikoerper, sterol carrier protein 2, liver antikoerper, sterol carrier protein 2a antikoerper, sterol carrier protein 2 L homeolog antikoerper, phospholipid transfer protein homolog1 antikoerper, uncharacterized LOC101116445 antikoerper, sterol carrier protein 2b antikoerper, SCP2 antikoerper, Scp2 antikoerper, scp2a antikoerper, scp2.L antikoerper, scp2 antikoerper, CC1G_13192 antikoerper, plt1 antikoerper, LOC101116445 antikoerper, scp2b antikoerper

Hintergrund: SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process